PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G235200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 135aa    MW: 15474.3 Da    PI: 5.7351
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G235200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.41.2e-112767345
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                        ++++E+ l+++  k+lG++ W +Ia +++ gRt++++ ++w 
  Aqcoe1G235200.1.p 27 EFSEDEESLIARMYKLLGNR-WVLIAGRLP-GRTAEEIENYWT 67
                       79******************.*********.***********5 PP

2Myb_DNA-binding315.9e-1078118345
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         ++++E el+ + +k+ G + W++Ia +++ gRt+ q+  +w 
  Aqcoe1G235200.1.p  78 EFSEDEAELIFRMFKLVGER-WHLIAGRIP-GRTAQQIEKYWT 118
                        59******************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512948.1992071IPR017930Myb domain
SMARTSM007174.4E-92472IPR001005SANT/Myb domain
SuperFamilySSF466895.62E-92468IPR009057Homeodomain-like
CDDcd001671.11E-72766No hitNo description
Gene3DG3DSA:1.10.10.605.0E-142768IPR009057Homeodomain-like
PfamPF002492.5E-102767IPR001005SANT/Myb domain
PROSITE profilePS5129410.06473125IPR017930Myb domain
SMARTSM007175.2E-875123IPR001005SANT/Myb domain
CDDcd001676.25E-778117No hitNo description
Gene3DG3DSA:1.10.10.604.9E-1278119IPR009057Homeodomain-like
SuperFamilySSF466891.4E-878121IPR009057Homeodomain-like
PfamPF002492.3E-878118IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 135 aa     Download sequence    Send to blast
MEILSHEYSI GTIKDSTKKT SIHVMKEFSE DEESLIARMY KLLGNRWVLI AGRLPGRTAE  60
EIENYWTSRQ TSLEDVREFS EDEAELIFRM FKLVGERWHL IAGRIPGRTA QQIEKYWTSR  120
YSSSASSSSS SSSD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011007896.11e-22PREDICTED: MYB-like transcription factor ETC1 isoform X1
SwissprotO220598e-16CPC_ARATH; Transcription factor CPC
TrEMBLD7TEM75e-22D7TEM7_VITVI; Putative uncharacterized protein
STRINGVIT_12s0059g02360.t011e-21(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46410.11e-16MYB_related family protein